PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G03900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 468aa    MW: 50247 Da    PI: 8.7243
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G03900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.62e-39182258278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cqve+C++dls+ak yhr+h+vCe hsk+ +v+v+gle+rfCqqCsrfh l efD++krsCrrrL++hn+rrrk+q+
  OMERI02G03900.1 182 CQVEDCNVDLSSAKPYHRKHRVCEPHSKTLKVIVAGLERRFCQQCSRFHGLAEFDQKKRSCRRRLHDHNARRRKPQP 258
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-32174243IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.351179256IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-38180261IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30182255IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGSFGMDWNQ KSSVLWDWEN MPPIGNSANE NPKNVMLAES KLAGVGVDIG HESGHSSGGT  60
FSSSSEIGYG SSKSSISASI DSPSKVGNTI ELNFASAKEH DKNMDKGKSK VDDTGTSRSP  120
VVAANRVEPL IGLKLGKRTY FEDVCGGQNV KSSPSGVSVA TPSPGLAKKV KVAQQNTQNP  180
HCQVEDCNVD LSSAKPYHRK HRVCEPHSKT LKVIVAGLER RFCQQCSRFH GLAEFDQKKR  240
SCRRRLHDHN ARRRKPQPEA ISLSSSRLST LLYGDARQQA SLLFGQAPYG QMGSCASSWD  300
NPVPGGFKFT ATKAPWSRLT RAAGVDGTHV SNQQAPGNVL PHGAHHSFDG LMAFKETNAK  360
VLNQGMEASA VASGSARGPD FERALSLLSI DSVGAANLQP GSQIHPGVTA IAGTSNPVMM  420
PSPAIWQGGL SLDQQAQFQA FDRLGNDDDD HIQLPKPSYD NSHYDQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-271822551184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237254KKRSCRRRLHDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429840.0AK242984.1 Oryza sativa Japonica Group cDNA, clone: J090094N03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626878.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626879.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626880.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626881.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626882.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626883.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626884.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
SwissprotA2X0Q60.0SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z80.0SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A0E0CFB80.0A0A0E0CFB8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA007499-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os02g04680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-42squamosa promoter binding protein-like 2